• Audio
  • Live tv
  • About Us
  • Contact Us
  • Privacy Policy
  • Terms of Service
Thursday, March 23, 2023
Morning News
No Result
View All Result
  • Login
  • Home
  • News
    • Local
    • National
    • World
  • Markets
  • Economy
  • Crypto
  • Real Estate
  • Sports
  • Entertainment
  • Health
  • Tech
    • Automotive
    • Business
    • Computer Sciences
    • Consumer & Gadgets
    • Electronics & Semiconductors
    • Energy & Green Tech
    • Engineering
    • Hi Tech & Innovation
    • Machine learning & AI
    • Security
    • Hardware
    • Internet
    • Robotics
    • Software
    • Telecom
  • Lifestyle
    • Fashion
    • Travel
    • Canadian immigration
  • App
    • audio
    • live tv
  • Home
  • News
    • Local
    • National
    • World
  • Markets
  • Economy
  • Crypto
  • Real Estate
  • Sports
  • Entertainment
  • Health
  • Tech
    • Automotive
    • Business
    • Computer Sciences
    • Consumer & Gadgets
    • Electronics & Semiconductors
    • Energy & Green Tech
    • Engineering
    • Hi Tech & Innovation
    • Machine learning & AI
    • Security
    • Hardware
    • Internet
    • Robotics
    • Software
    • Telecom
  • Lifestyle
    • Fashion
    • Travel
    • Canadian immigration
  • App
    • audio
    • live tv
No Result
View All Result
Morning News
No Result
View All Result
Home Economy

No more changing the clocks? Bipartisan bill to make daylight-saving time permanent rolled out — again.

by author
March 16, 2023
in Economy
Reading Time: 1 min read
0 0
A A
0
0
SHARES
11
VIEWS
Share on FacebookShare on TwitterLinkedinReddit

Lawmakers from both sides of the aisle launched a fresh push this month for a bill that would make the U.S. stick with daylight-saving time all year, with the move coming as most Americans are due to spring forward by an hour on Sunday.

The Senate unanimously approved the measure a year ago, but the Sunshine Protection Act didn’t find traction last year in the House of Representatives, as the head of one key committee said it’s not clear whether it’s better to make daylight-saving time permanent or stick year-round with standard…

Tags: article_normalclocksdaylightsavingtimedstspringforwardfallback
Previous Post

Mississauga makes list of most searched-for housing markets

Next Post

B.C. budget: $4.2B deficit forecast as province spends on health care, housing, affordability

Related Posts

Economy

Australia to buy up to 5 U.S. nuclear-powered submarines

March 23, 2023
11
Economy

Ontario to table budget amid both surging revenues, potential slowdown

March 23, 2023
12
Next Post

B.C. budget: $4.2B deficit forecast as province spends on health care, housing, affordability

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

POPULAR TODAY

A woman holds out her hands to a physician.
Health

Osteoarthritis: Experimental Drug May Help Reduce Inflammation and Symtpoms, Early Study Finds

by author
March 23, 2023
0
14

Share on PinterestMilorad Kravic/Getty ImagesA new study finds a drug compound was able to help reduce inflammation in joints affected...

rent buy home mississauga

Rents are much lower than home mortgages right now in Mississauga: report

March 23, 2023
13
coffee

What to know about new research on coffee and heart risks

March 23, 2023
13

Five burning questions about ChatGPT, answered by humans

March 23, 2023
13
Gwyneth Paltrow

Gwyneth Paltrow: Why Some Experts Label Her Restrictive Diet as ‘Disordered Eating’

March 23, 2023
13

POPULAR NEWS

Biden backs tax hike on investment income to bolster Medicare, as he rolls out his budget proposal

March 20, 2023
19

Why Ray Dalio says SVB collapse is a ‘canary in the coal mine’

March 21, 2023
19

Hackers scored data center logins for big corporations more than a year ago. Now they’re selling that information

March 21, 2023
16

A new way to trap radioactive waste in minerals for long-term storage

March 21, 2023
15
A woman looks at a packet of birth control pills

Study Finds Similar Association of Progestin-only and Combined Hormonal Contraceptives with Breast Cancer Risk

March 22, 2023
14

EDITOR'S PICK

Economy

Former finance minister says Freeland faces tough choices on 2023 budget

by author
March 10, 2023
0
11

The federal Liberal government faces tough choices as it crafts a 2023 budget in a high-interest rate, high-inflation environment, a...

Read more

‘Celebration of bravery’: Ukrainian living in Victoria reflects on war’s 1-year anniversary

‘Sister Wives’ Star Christine Brown Goes Instagram Official With New Boyfriend Following Kody Brown Breakup

This Protein May Target Major Cause of Obesity, Mouse Study Finds

Meghan McCain Claims She’s Being Urged To Take Ozempic For Weight Loss Weeks After Giving Birth

Morning News

Welcome to our Ads

Create ads focused on the objectives most important to your business Please contact us info@morns.ca

  • Home
  • Audio
  • Live tv
  • About Us
  • Contact Us
  • Privacy Policy
  • Terms of Service

© 2022 Morning News - morns.ca by morns.ca.

No Result
View All Result
  • Home
  • News
    • Local
    • National
    • World
  • Markets
  • Economy
  • Crypto
  • Real Estate
  • Sports
  • Entertainment
  • Health
  • Tech
    • Automotive
    • Business
    • Computer Sciences
    • Consumer & Gadgets
    • Electronics & Semiconductors
    • Energy & Green Tech
    • Engineering
    • Hi Tech & Innovation
    • Machine learning & AI
    • Security
    • Hardware
    • Internet
    • Robotics
    • Software
    • Telecom
  • Lifestyle
    • Fashion
    • Travel
    • Canadian immigration
  • App
    • audio
    • live tv
  • Login

© 2022 Morning News - morns.ca by morns.ca.

Welcome Back!

Sign In with Facebook
Sign In with Google
Sign In with Linked In
OR

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In
Go to mobile version